Protein Info for PFR28_00593 in Pseudomonas sp. RS175

Annotation: HTH-type transcriptional regulator GntR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 PF00356: LacI" amino acids 17 to 62 (46 residues), 47.8 bits, see alignment 1.9e-16 PF00532: Peripla_BP_1" amino acids 74 to 320 (247 residues), 87.6 bits, see alignment E=2.1e-28 PF13407: Peripla_BP_4" amino acids 76 to 295 (220 residues), 38.5 bits, see alignment E=2e-13 PF13377: Peripla_BP_3" amino acids 182 to 343 (162 residues), 108.3 bits, see alignment E=9.4e-35

Best Hits

KEGG orthology group: K06145, LacI family transcriptional regulator, gluconate utilization system Gnt-I transcriptional repressor (inferred from 96% identity to pba:PSEBR_a1237)

Predicted SEED Role

"Gluconate utilization system Gnt-I transcriptional repressor" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>PFR28_00593 HTH-type transcriptional regulator GntR (Pseudomonas sp. RS175)
MTAPKNDKNTRTTGRPTLNEVARLAGVSPITASRALRGVSTVATELVDKVRQAAVELNYV
VNPAARALASAQSHSVVVLVPSLSNLLFIDTLEAIHRVLRPKGFEVVIGNYHYSRDEEED
LLRNYMAYQPRGLLLTGFDRTESARRMIEASNIPCVYMMELDPGAGLNCVGFSQLKAGET
AAEHLISRGRKRLAYIGAQLDQRTLLRGEGFRRALQKAGLYDPDLELLTPRPSSVGLGGE
LFLQLLASHPDVDAIFFGNDDLAHGALFEALRCGIRIPEQISVLGFNDLPASAHMVPRLS
SISTPREAIGQRAAEQMLTLMAGNRIAQPVVDLGFELKIREST