Protein Info for PFR28_00573 in Pseudomonas sp. RS175

Annotation: Glucose-6-phosphate 1-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00871: glucose-6-phosphate dehydrogenase
  • amino acids 8 to 485 (478 residues), 577 bits, E=1.6e-177
• PF00479: G6PD_N
  • amino acids 13 to 184 (172 residues), 171.7 bits, E=2.6e-54
• PF02781: G6PD_C
  • amino acids 187 to 485 (299 residues), 404.6 bits, E=2.2e-125

Best Hits

Swiss-Prot: 76% identical to G6PD_PSEAE: Glucose-6-phosphate 1-dehydrogenase (zwf) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00036, glucose-6-phosphate 1-dehydrogenase [EC: 1.1.1.49] (inferred from 97% identity to pba:PSEBR_a1219)

Predicted SEED Role

"Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49)" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 1.1.1.49)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (17/17 steps found)
• aspartate superpathway (22/25 steps found)
• heterolactic fermentation (16/18 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• pentose phosphate pathway (8/8 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• Entner-Doudoroff pathway I (8/9 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (7/8 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• pentose phosphate pathway (oxidative branch) I (3/3 steps found)
• cytosolic NADPH production (yeast) (4/5 steps found)
• L-lysine biosynthesis II (6/9 steps found)
• formaldehyde oxidation I (3/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Glutathione metabolism
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.49

Use Curated BLAST to search for 1.1.1.49

Protein Sequence (489 amino acids)

>PFR28_00573 Glucose-6-phosphate 1-dehydrogenase (Pseudomonas sp. RS175)
MPPITVEPCTFALFGALGDLALRKLFPALYQLDAAGLLHEDTCILALAREPGSEQQHLAF
IGTELRRYVGDKDLSETVVERFMARLTYLHVDFLKADDYVALAEQAGSAQQVIAYFATPA
AVYGAICENLAKVGLSENTRVVLEKPIGSDLESSRKVNDAVAQFFPENRTYRIDHYLGKE
TVQNLIALRFANSLFETQWNQNYISHVEITVAEKVGIEGRWGYFDKAGQLRDMIQNHLLQ
LLCLIAMDPPADLSADSIRDEKVKVLKALAPISPEGLTTQVVRGQYIAGHSEGKAVPGYL
EEPNSNTQSDTETFVALRADIRNWRWAGVPFYLRTGKRMPQKLSQIVIHFKEPSHYIFAP
EQRLQISNKLIIRLQPDEGISLRVMTKEQGLDKGMQLRSGPLQLNFSDTWRSARIPDAYE
RLLLEVMNGNQNLFVRKDEIEAAWTWCDQLIAGWKKSGDAPKPYAAGSWGPMSSIALITR
DGRSWYGDI