Protein Info for PFR28_00567 in Pseudomonas sp. RS175

Annotation: Melibiose/raffinose/stachyose import permease protein MelD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 23 to 46 (24 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 164 to 189 (26 residues), see Phobius details amino acids 210 to 235 (26 residues), see Phobius details amino acids 271 to 293 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 93 to 290 (198 residues), 52.6 bits, see alignment E=2.5e-18

Best Hits

Swiss-Prot: 36% identical to Y1215_PYRHO: Probable ABC transporter permease protein PH1215 (PH1215) from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 99% identity to pfo:Pfl01_4369)

Predicted SEED Role

"Glucose ABC transport system, inner membrane component 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>PFR28_00567 Melibiose/raffinose/stachyose import permease protein MelD (Pseudomonas sp. RS175)
MSSVAVFSKASPFDALQRWLPKLVLAPSMFIVLVGFYGYILWTFVLSFTTSTFLPTYKWA
GLAQYARLWDNDRWWVASKNLAVFGGMFIGITLVIGVLLAVFLDQRIRREGFIRTIYLYP
MALSMIVTGTAWKWLLNPGMGLDKLLRDWGWEGFRLDWLIDPDRVVYCLVIAAVWQASGF
IMAMFLAGLRGVDQSIIRAAQIDGASMPRIYWKVVLPSLRPVFFSAVMILAHIAIKSFDL
VAAMTAGGPGYSSDLPAMFMYSFTFSRGQMGMGSASAILMLGAILAIIVPYLYSELRTKR
HD