Protein Info for PFR28_00489 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 879 transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details amino acids 237 to 260 (24 residues), see Phobius details amino acids 266 to 283 (18 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details amino acids 317 to 335 (19 residues), see Phobius details amino acids 349 to 373 (25 residues), see Phobius details amino acids 395 to 412 (18 residues), see Phobius details amino acids 421 to 441 (21 residues), see Phobius details amino acids 447 to 465 (19 residues), see Phobius details amino acids 477 to 498 (22 residues), see Phobius details amino acids 521 to 540 (20 residues), see Phobius details amino acids 858 to 877 (20 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 36 to 327 (292 residues), 39.7 bits, see alignment E=4.4e-14 PF09924: LPG_synthase_C" amino acids 565 to 851 (287 residues), 318.5 bits, see alignment E=3.9e-99

Best Hits

KEGG orthology group: K14205, phosphatidylglycerol lysyltransferase [EC: 2.3.2.3] (inferred from 96% identity to pba:PSEBR_a1139)

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (879 amino acids)

>PFR28_00489 hypothetical protein (Pseudomonas sp. RS175)
MRAHSDPQDTVSATQPIKAERLRWLDRISQYRQPIGLAVTLLLFAIALIACRHLLSELDL
YALHDSILDVPRPALLGAVAATVAGFIILLGYEWSASRYAGVTLPPQTLILGGFTAFAIG
NAIGLSLLSGGSVRYRLYARHGLGAADVAHMTLFASLSLGCALPPLAALATLSNLPAASA
ALHLPAPLLAAISVAVLLLMGILAVGIYRRRLPEQPHRDSLLVRAGRRTLRLPGRRLTFL
QLVITALDVAAAATVLYLLLPEAPPFGAFLLVYLLALAAGVLSHVPGGVGVFEAILLAAF
ADKLGAAPLAAALLLYRLIYVLLPMLVACVLLLINEAQRLFQTRQTLRAASGLAAPVLAV
LVFLSGVVLLFSGVTPEIDTRLEHIGFLIPHRLVDASHFGASLVGVLCLLLAQGLRRRLS
AAWMLTTVLLLVGALLSLLKGFDWEEATLLTLTAALLAVFRRSFYRPSRLTELPFSPLFL
IASLCVLGASIWLLLFAYQDVPYSHQLWWQFTLDADAPRGLRSLLGAAVLLVVVSLTWLL
RTARPVIHLPTAQELERAKTILMASSQPDGGLALTGDKALLFHPNDEAFLMYARRGRSLV
ALYDPIGPPQQRAEMIWQFRDLCDVHHARPVFYQVRVENLPYYMDIGLTAIKLGEEARID
LKRFDLEAKGKEMKDLRYTWNRGTRDGLSLEIHEPGQAPMDELKVISDAWLTGKNVREKG
FSLGRFSDEYLKHFRIAVIRFEGRPVAFANLLETHSHELASLDLMRAHPDAPKLTMEFMM
VGLIQHYKNHGYARFSLGMVPLSGLQPRRGAPLTQRLGSMVFRRGEQLYNFQGLRRFKDK
FQPDWEPRYMAMPAGLDPLVALADTAALIAGGLTGLVKR