Protein Info for PFR28_00403 in Pseudomonas sp. RS175

Annotation: Regulator of sigma-E protease RseP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 382 to 411 (30 residues), see Phobius details amino acids 423 to 444 (22 residues), see Phobius details TIGR00054: RIP metalloprotease RseP" amino acids 2 to 450 (449 residues), 391.6 bits, see alignment E=2.1e-121 PF02163: Peptidase_M50" amino acids 10 to 436 (427 residues), 251.2 bits, see alignment E=1.5e-78 PF00595: PDZ" amino acids 126 to 180 (55 residues), 23.7 bits, see alignment 1e-08 amino acids 225 to 265 (41 residues), 24.1 bits, see alignment 7.5e-09 PF17820: PDZ_6" amino acids 129 to 158 (30 residues), 28.6 bits, see alignment (E = 2.1e-10) amino acids 229 to 278 (50 residues), 42.1 bits, see alignment 1.2e-14 PF13180: PDZ_2" amino acids 226 to 289 (64 residues), 34.3 bits, see alignment E=4.7e-12

Best Hits

Swiss-Prot: 77% identical to Y3649_PSEAE: Putative zinc metalloprotease PA3649 (PA3649) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K11749, regulator of sigma E protease [EC: 3.4.24.-] (inferred from 96% identity to pba:PSEBR_a1072)

MetaCyc: 47% identical to intramembrane zinc metalloprotease RseP (Escherichia coli K-12 substr. MG1655)
3.4.21.-; RXN-18678

Predicted SEED Role

"Membrane-associated zinc metalloprotease" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>PFR28_00403 Regulator of sigma-E protease RseP (Pseudomonas sp. RS175)
MSALYMIVGTLVALGVLVTFHEFGHFWVARRCGVKVLRFSVGFGMPLLRWHDKSGTEFVV
AAIPLGGYVKMLDEREGEVPADQLHQSFNRKTVRQRIAIVAAGPVANFLLALVFFWALAM
LGSEQVRPVIGGVEAGSVAARAGLSPGQEIVAIDGEPTSGWAAVNLQLVRRLGESGSLQL
MVRDEGSTTDSPRELVLDNWLKGADEPDPIRSLGIRPWRPALPPILAELDPKGPAQAAGL
KTGDRLLALDGQPVGDWQQVVDAVRVRPDTKIVLRIERDGAPIDVPVTLGARGESKAPNG
YLGAGVKAVDWPPEMIREVSFGPVAAIGEGARRTWTMSVLTLDSLKKMLFGELSVKNLSG
PITIAKVAGASAQSGVADFLNFLAYLSISLGVLNLLPIPVLDGGHLLFYLIEWARGRPLS
DRVQGWGIQIGISLVVGVMLLALVNDLGRL