Protein Info for PFR28_00325 in Pseudomonas sp. RS175

Annotation: Inner membrane protein YpjD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01578: Cytochrom_C_asm
  • amino acids 43 to 267 (225 residues), 135.6 bits, E=9.5e-44

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a988)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

• L-citrulline biosynthesis (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Protein Sequence (270 amino acids)

>PFR28_00325 Inner membrane protein YpjD (Pseudomonas sp. RS175)
MLPLSPSLLASLAAACLYAAATLYQGTRLASGARANKRLLVTLGVLAVLGHAASLYTHLM
TPIGLGLDFFNAASLIAVAVIGLTLLACSRIPVENLLVLLFPLGLATVLLAQFAPSGTVQ
IIDEEPGILAHILLSILAYGLFTIAVFQALLLLVQDHQLKHKHPSGLIRNFPPLQTMESL
LFGFLWAGWTLLSLSLISGWLFVENLFAQHLVHKTLLACLAWVVFSVLLWGRNRLGWRGH
KAIRWTLAGFCLLMLAYFGSKLVREYILHI