Protein Info for PFR28_00303 in Pseudomonas sp. RS175

Annotation: Omega-amidase YafV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF00795: CN_hydrolase" amino acids 12 to 248 (237 residues), 122 bits, see alignment E=1.4e-39

Best Hits

Swiss-Prot: 52% identical to YAFV_YEREN: Omega-amidase YafV (yafV) from Yersinia enterocolitica

KEGG orthology group: K08590, carbon-nitrogen hydrolase family protein (inferred from 89% identity to pba:PSEBR_a942)

Predicted SEED Role

"Aliphatic amidase AmiE (EC 3.5.1.4)" (EC 3.5.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>PFR28_00303 Omega-amidase YafV (Pseudomonas sp. RS175)
MRDLSMLPNLNVALIQTTLAWHDREANLEHFESLLEQARGADLVILPEMFTTGFSMESQA
LAEPEHGPTSVWLRTQASRLDAVITGSLIVQAADGSHRNRLLWARPDGEVLHYDKRHLFR
MAGEHNHYTPGERQVLFELKGWRVRPLICYDLRFPAWSRDAEDTDLLLYTANWPGARRLH
WNRLLPARAIENLCYVAAVNRIGTDGKGFAYTGDSQVLDFQGETLLSVGEADGVFMVNLN
AADLAAYRARFPANLDADRFEFI