Protein Info for PFR28_00303 in Pseudomonas sp. RS175

Annotation: Omega-amidase YafV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00795: CN_hydrolase
  • amino acids 12 to 248 (237 residues), 122 bits, E=1.4e-39

Best Hits

Swiss-Prot: 52% identical to YAFV_YEREN: Omega-amidase YafV (yafV) from Yersinia enterocolitica

KEGG orthology group: K08590, carbon-nitrogen hydrolase family protein (inferred from 89% identity to pba:PSEBR_a942)

Predicted SEED Role

"Aliphatic amidase AmiE (EC 3.5.1.4)" (EC 3.5.1.4)

MetaCyc Pathways

• indole-3-acetate biosynthesis III (bacteria) (2/2 steps found)
• L-arginine degradation X (arginine monooxygenase pathway) (2/3 steps found)
• acrylonitrile degradation I (1/2 steps found)
• indole-3-acetate biosynthesis IV (bacteria) (1/2 steps found)
• superpathway of acrylonitrile degradation (1/3 steps found)
• indole-3-acetate biosynthesis II (4/12 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Cyanoamino acid metabolism
• Phenylalanine metabolism
• Styrene degradation
• Tryptophan metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.4

Protein Sequence (263 amino acids)

>PFR28_00303 Omega-amidase YafV (Pseudomonas sp. RS175)
MRDLSMLPNLNVALIQTTLAWHDREANLEHFESLLEQARGADLVILPEMFTTGFSMESQA
LAEPEHGPTSVWLRTQASRLDAVITGSLIVQAADGSHRNRLLWARPDGEVLHYDKRHLFR
MAGEHNHYTPGERQVLFELKGWRVRPLICYDLRFPAWSRDAEDTDLLLYTANWPGARRLH
WNRLLPARAIENLCYVAAVNRIGTDGKGFAYTGDSQVLDFQGETLLSVGEADGVFMVNLN
AADLAAYRARFPANLDADRFEFI