Protein Info for PFR28_00276 in Pseudomonas sp. RS175
Annotation: S-adenosylmethionine:tRNA ribosyltransferase-isomerase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 94% identical to QUEA_PSEPF: S-adenosylmethionine:tRNA ribosyltransferase-isomerase (queA) from Pseudomonas fluorescens (strain Pf0-1)
KEGG orthology group: K07568, S-adenosylmethionine:tRNA ribosyltransferase-isomerase [EC: 5.-.-.-] (inferred from 99% identity to pba:PSEBR_a915)MetaCyc: 71% identical to tRNA preQ134 S-adenosylmethionine ribosyltransferase-isomerase (Escherichia coli K-12 substr. MG1655)
RXN0-1342 [EC: 2.4.99.17]
Predicted SEED Role
"S-adenosylmethionine:tRNA ribosyltransferase-isomerase (EC 5.-.-.-)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 5.-.-.-)
MetaCyc Pathways
- queuosine biosynthesis I (de novo) (4/4 steps found)
- queuosine biosynthesis III (queuosine salvage) (3/5 steps found)
KEGG Metabolic Maps
- Biosynthesis of steroids
- Carotenoid biosynthesis - General
- Lipopolysaccharide biosynthesis
- Pentose and glucuronate interconversions
Isozymes
Compare fitness of predicted isozymes for: 5.-.-.-
Use Curated BLAST to search for 2.4.99.17 or 5.-.-.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (349 amino acids)
>PFR28_00276 S-adenosylmethionine:tRNA ribosyltransferase-isomerase (Pseudomonas sp. RS175) MRVADFTFDLPDSLIARHPLAERRASRLLTLDGVSGAMAHRQFTDLLEHLRPGDLMVFNN TRVIPARLFGQKASGGKLEILVERVLDSHRVLAHVRSSKSPKPGSSILIDGGGEAVMVAR HDALFELEFAEEVLPLLDRVGHMPLPPYIDRPDEGSDRERYQTVYAERLGAVAAPTAGLH FDQPLLEAIAAKGVETAFVTLHVGAGTFQPVRVERIEDHHMHNEWLEVSQEVVDAVAACR ARGGRVVAVGTTSVRSLESAARDGVLKPFSGDTDIFIYPGRPFHVVDALVTNFHLPESTL LMLVSAFAGYPETMAAYKAAVEHGYRFFSYGDAMFITRNPAPRGPEETV