Protein Info for PFR28_00138 in Pseudomonas sp. RS175

Annotation: Vitamin B12 transport ATP-binding protein BacA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 575 transmembrane" amino acids 39 to 59 (21 residues), see Phobius details amino acids 79 to 101 (23 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 278 to 301 (24 residues), see Phobius details PF06472: ABC_membrane_2" amino acids 34 to 302 (269 residues), 201.8 bits, see alignment E=2.1e-63 PF05992: SbmA_BacA" amino acids 39 to 351 (313 residues), 139.6 bits, see alignment E=2.5e-44 PF00005: ABC_tran" amino acids 387 to 521 (135 residues), 57.9 bits, see alignment E=2.7e-19

Best Hits

KEGG orthology group: K02471, putative ATP-binding cassette transporter (inferred from 94% identity to pba:PSEBR_a815)

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (575 amino acids)

>PFR28_00138 Vitamin B12 transport ATP-binding protein BacA (Pseudomonas sp. RS175)
MNQNAEYSAVNDAVRGQFFRRVWQMTTPYWRSEEKGKAWTLLIAVIALSLFSVAISVWVN
SWYKDFYNALQEKNDTAFWQLILYFCGIAAVAILGAVYRLYLTQMLTIRWRAWLTEQHFA
RWLNNKNYYRLEQGGYTDNPDQRISEDLNSFTTNTLGLGLGLLRTVVSLVSFSIILWGVS
GSIEVFGYTIPGYMFWCALVYAAVGSWLTHLIGRRLIGLNNNQQRFEADLRFSMVRVREN
AESIALYNGEPNENRRLSGRFGLVWHNFWDIMRVSKRLTFFTSGYGQIAIIFPFMVAAPR
YFAGKIQLGELMQINSAFGNVQENFSWFIDAYAQLAEWRATCDRLLSFRQAMSDNEERVP
AIEVENQGSLLKVENLGLDVADGRHLLSNAAMTVEPGERVMLSGRSGSGKSTLFRAMGHL
WPTGHGRILLPAARYLFLPQKPYLPIGSLREVLSYPQPGDVYPNERYAQVLETCRLPHLV
SRLDESNHWQRMLSPGEQQRLAFARALLYAPLWLYMDEATSAMDEEDEATLYQALIDQLP
GLSIVSVGHRSSLKRFHPRQVRIENGQLVEHTVTA