Protein Info for PFR28_00120 in Pseudomonas sp. RS175

Annotation: C4-dicarboxylate TRAP transporter small permease protein DctQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 transmembrane" amino acids 14 to 37 (24 residues), see Phobius details amino acids 61 to 71 (11 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details PF04290: DctQ" amino acids 65 to 183 (119 residues), 78.3 bits, see alignment E=2.5e-26

Best Hits

Swiss-Prot: 75% identical to DCTQ_PSEAE: C4-dicarboxylate TRAP transporter small permease protein DctQ (dctQ) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K11689, C4-dicarboxylate transporter, DctQ subunit (inferred from 92% identity to pba:PSEBR_a876)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (210 amino acids)

>PFR28_00120 C4-dicarboxylate TRAP transporter small permease protein DctQ (Pseudomonas sp. RS175)
MNALRRTWEHFEEGFIAFLLAAMTLVTFVYVVLNNLYSVFYSLGDRWPGASELLFATGDS
IMAMAQAMTWSTSLTKALFGWLIFFGLSYGVRTAGHIGVDALVKLASKPVQRFIGVIACL
CCLAYAGLLAVASFEWINTLMIAQIGAEDLGHFGIMQWHIGLIVPVGFALVFIRFAEILV
RILGNRQTGLGLADEAAEAVKLTEHEEDRP