Protein Info for PFR28_00063 in Pseudomonas sp. RS175

Annotation: Glycolate permease GlcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 563 transmembrane" amino acids 13 to 35 (23 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 72 to 94 (23 residues), see Phobius details amino acids 116 to 148 (33 residues), see Phobius details amino acids 154 to 179 (26 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 252 to 269 (18 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details amino acids 307 to 329 (23 residues), see Phobius details amino acids 334 to 351 (18 residues), see Phobius details amino acids 358 to 375 (18 residues), see Phobius details amino acids 380 to 400 (21 residues), see Phobius details amino acids 418 to 436 (19 residues), see Phobius details amino acids 443 to 467 (25 residues), see Phobius details amino acids 539 to 558 (20 residues), see Phobius details TIGR00795: transporter, lactate permease (LctP) family" amino acids 7 to 555 (549 residues), 735.8 bits, see alignment E=1.6e-225 PF02652: Lactate_perm" amino acids 16 to 551 (536 residues), 689.7 bits, see alignment E=1.5e-211

Best Hits

Swiss-Prot: 76% identical to GLCA_ECOLI: Glycolate permease GlcA (glcA) from Escherichia coli (strain K12)

KEGG orthology group: K03303, lactate transporter, LctP family (inferred from 97% identity to pba:PSEBR_a754)

MetaCyc: 76% identical to glycolate/lactate:H+ symporter GlcA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-104; TRANS-RXN-105; TRANS-RXN0-515; TRANS-RXN0-622

Predicted SEED Role

"L-lactate permease" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (563 amino acids)

>PFR28_00063 Glycolate permease GlcA (Pseudomonas sp. RS175)
MQTWQQLYSPLGSLGLSALAAVIPIVFFFLALAVFRLKGHVAGSITLALAIAVAILAFQM
PVDMALAAAGYGFAYGLWPIAWIIVAAVFLYKLTVKSGQFEVIRSSVLSITDDQRLQVLL
IGFCFGAFLEGAAGFGAPVAITAALLVGLGFNPLYAAGLCLIANTAPVAFGALGIPIIVA
GQVTGIDAFKIGAMTGRQLPLLSLFVPFWLVFMMDGLRGVRETWPAALVAGLSFAITQYF
TSNFIGPELPDITSALASLISLTLFLKVWQPKRTAGAQIAGTSVGAAVASVGGFGQPRST
VASPYSLGEIIKAWSPFLILTVLVTIWTLKPFKAMFAAGGSMYGWVFNFAIPHLDKMVVK
VAPIVVTPTAIPAVFKLDPISATGTAIFFSALISMLVLKINFKTGLTTFKETFFELRWPI
LSIGMVLAFAFVTNYSGMSSTMALVLAGTGAAFPFFSPFLGWLGVFLTGSDTSSNALFSS
LQATTAHQIGVNDTLLVAANTSGGVTGKMISPQSIAVACAATGLVGKESDLFRFTLKHSL
FFATIVGLITLAQAYWFTGMLVH