Protein Info for PFR28_00061 in Pseudomonas sp. RS175

Annotation: Lactate utilization protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 TIGR00273: iron-sulfur cluster-binding protein" amino acids 24 to 443 (420 residues), 485.3 bits, see alignment E=8.4e-150 PF02589: LUD_dom" amino acids 76 to 300 (225 residues), 170.9 bits, see alignment E=8.2e-54 PF13183: Fer4_8" amino acids 317 to 383 (67 residues), 47.6 bits, see alignment E=6.1e-16 PF13534: Fer4_17" amino acids 318 to 383 (66 residues), 24 bits, see alignment E=1.4e-08 PF11870: LutB_C" amino acids 391 to 477 (87 residues), 91.8 bits, see alignment E=8.8e-30

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a752)

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF" in subsystem L-rhamnose utilization or Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (485 amino acids)

>PFR28_00061 Lactate utilization protein B (Pseudomonas sp. RS175)
MSTPTLIPTVEVSEDFRARAHKALDDTQLRNNFRSAMDSLMTKRATSFSDAHEREHLRVL
GNAVRARALSKLPDLLEQLESNLTRNGVKVHWAETVDEANGIVLSIIRAHEARQVIKGKS
MVSEEMEMNHVLAAQGIECLESDMGEFIVQLDHEKPSHIIMPAIHKNAGQVASLFHDKLG
VEYTKDVDQLIQIGRRVLRQKFFEADIGVSGVNFAVAETGTLLLVENEGNGRMSTTVPPV
HIAVTGIEKVVENLRDVVPLLSLLTRSALGQPITTYVNMISGPRKAQELDGPQEVHLVLL
DNGRSQAFADSELRQTLNCIRCGACMNHCPVYTRIGGHAYGEVYPGPIGKIITPHMVGLA
KVPDHPSASSLCGACGEVCPVKIPIPALLRRLREENVKALDSPHQVMRGQGSKYSPRERF
IWNAWARLNSSPRLYRLFAYLATRLRALTPRNVGPWTQNHSAPKPAARSLHDLAREHLNP
QGDRR