Protein Info for PFR28_00042 in Pseudomonas sp. RS175
Annotation: 1-aminocyclopropane-1-carboxylate deaminase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 97% identical to 1A1D_PSEFL: 1-aminocyclopropane-1-carboxylate deaminase (acdS) from Pseudomonas fluorescens
KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a2187)MetaCyc: 37% identical to L-cysteate sulfo-lyase (Roseovarius nubinhibens ISM)
L-cysteate sulfo-lyase. [EC: 4.4.1.25]
Predicted SEED Role
"1-aminocyclopropane-1-carboxylate deaminase (EC 3.5.99.7)" (EC 3.5.99.7)
MetaCyc Pathways
- superpathway of branched chain amino acid biosynthesis (17/17 steps found)
- superpathway of L-isoleucine biosynthesis I (13/13 steps found)
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
- L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
- glycine betaine degradation III (7/7 steps found)
- D-serine degradation (3/3 steps found)
- L-serine degradation (3/3 steps found)
- L-methionine biosynthesis II (5/6 steps found)
- glycine betaine degradation I (6/8 steps found)
- superpathway of L-threonine metabolism (13/18 steps found)
- L-cysteine degradation II (2/3 steps found)
- L-methionine degradation II (2/3 steps found)
- L-tryptophan degradation II (via pyruvate) (2/3 steps found)
- sulfolactate degradation III (2/3 steps found)
- L-threonine degradation I (4/6 steps found)
- purine nucleobases degradation II (anaerobic) (16/24 steps found)
- superpathway of sulfolactate degradation (3/6 steps found)
- felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
- L-mimosine degradation (4/8 steps found)
- glutathione-mediated detoxification I (3/8 steps found)
- hypoglycin biosynthesis (4/14 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 3.5.99.7
Use Curated BLAST to search for 3.5.99.7 or 4.4.1.25
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (338 amino acids)
>PFR28_00042 1-aminocyclopropane-1-carboxylate deaminase (Pseudomonas sp. RS175) MNLNRFKRYPLTFGPSPITPLKRLSEHLGGKVQLYAKREDCNSGLAFGGNKTRKLEYLIP EAIEQGCDTLVSIGGIQSNQTRQVAAVAAHLGMKCVLVQENWVNYSDAVYDRVGNIEMSR IMGAEVRLDAAGFDIGIRPSWEKAMDDVVSRGGKPFPIPAGCSEHPYGGLGFVGFAEEVR EQEKQLGFTFDYIVVCSVTGSTQAGMVVGFAAHGRSKQVIGIDASAKPEKTKAQILRIAR HTAELVELGREITEEDVVLDTRFAYPEYGLPNDGTLEAIRLCGSLEGVLTDPVYEGKSMH GMIEMVRRGEFPEGSKVLYAHLGGAPALNAYSFLFRNG