Protein Info for PFR28_00018 in Pseudomonas sp. RS175

Annotation: Na(+), Li(+), K(+)/H(+) antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 313 to 336 (24 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details amino acids 379 to 397 (19 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 356 (333 residues), 108.3 bits, see alignment E=2.1e-35

Best Hits

KEGG orthology group: None (inferred from 56% identity to pen:PSEEN1406)

Predicted SEED Role

"Multidrug resistance protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>PFR28_00018 Na(+), Li(+), K(+)/H(+) antiporter (Pseudomonas sp. RS175)
MKDLSGELTVSGEARVYTRPVVLLLSATFVLTIARAMALPYLVVYFSQAFGLGVTDIGLV
VGGALIVSSVLGVYGGFLVDRFSNDRILLAAASLFALAFAVAFQVGSLVPFIIAIVVVNL
SYAVVDIAVKSGIGFLVTPDKRGGVFSMKYTLTNVGYAIGPFLGVLFAKISPGMPFAVSA
IIGAGFVAFYSSLGARLPRAGQTERTNQPFARVLVHLVRNYRLVCFTIGGVLSAIVFGQF
TAYLSQYLIVTSTPENTYRIINYLVTTNACVVIGLQYLIGSRIHQKNLFRMLMLGMAFFI
AGLMGFAHAQAWMAWVVAMIIFTVGEIIIIPAEYLFIDYIAPEDMRGVYYGAQNLSNLGA
ALGPVLCGFVLSLYAPQAMFHVLSLCVVAASVFYFLGSRRKG