Protein Info for PFLU_RS30530 in Pseudomonas fluorescens SBW25

Annotation: acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR03570: sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family" amino acids 6 to 217 (212 residues), 183.9 bits, see alignment E=1.4e-58 PF17836: PglD_N" amino acids 6 to 94 (89 residues), 34.9 bits, see alignment E=1.9e-12 PF00132: Hexapep" amino acids 168 to 202 (35 residues), 31.8 bits, see alignment 8.1e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU1665)

Predicted SEED Role

"bacterial transferase, hexapeptide repeat protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K729 at UniProt or InterPro

Protein Sequence (221 amino acids)

>PFLU_RS30530 acetyltransferase (Pseudomonas fluorescens SBW25)
MTRVKKLVILGAGGFGREVHAWLLDSIRSGACKPTDEVIWKIAGFIDDFSNAPDIFPGLP
PILSKIDEYEPEPDSYVVCAIADPAAKKVLANKLLLKGVKFFSLIHSSVVVGTNVTIGKG
AVICPFTVLSSDLVVGSFVTINSGCTIGHDSSIADYCTLSGHCDITGGAKLEEGAFLGSH
AVIIPKVTVGEYAVVGAGSVVIRKVGPGVTVFGVPAKRISG