Protein Info for PFLU_RS30315 in Pseudomonas fluorescens SBW25

Annotation: DUF1328 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 54 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 49 (21 residues), see Phobius details PF07043: DUF1328" amino acids 6 to 43 (38 residues), 61.1 bits, see alignment E=5.3e-21

Best Hits

Swiss-Prot: 100% identical to Y093_PSEF5: UPF0391 membrane protein PFL_0093 (PFL_0093) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: None (inferred from 96% identity to psp:PSPPH_0249)

Predicted SEED Role

"probable exported protein YPO0432"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K6U0 at UniProt or InterPro

Protein Sequence (54 amino acids)

>PFLU_RS30315 DUF1328 domain-containing protein (Pseudomonas fluorescens SBW25)
MLSWAITFLIIAIVAAVLGFGGIAGTATGIAKILFVVFLVMFIASFFFGRRGRG