Protein Info for PFLU_RS30010 in Pseudomonas fluorescens SBW25
Annotation: cardiolipin synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to CLSA_PSEFS: Cardiolipin synthase A (clsA) from Pseudomonas fluorescens (strain SBW25)
KEGG orthology group: K06131, cardiolipin synthase [EC: 2.7.8.-] (inferred from 100% identity to pfs:PFLU6096)Predicted SEED Role
"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)
MetaCyc Pathways
- cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)
- cardiolipin biosynthesis II (2/3 steps found)
- superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)
KEGG Metabolic Maps
- Aminophosphonate metabolism
- Glycerophospholipid metabolism
- High-mannose type N-glycan biosynthesis
- Nucleotide sugars metabolism
- Sphingolipid metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.7.8.-
Use Curated BLAST to search for 2.7.8.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See C3K1C4 at UniProt or InterPro
Protein Sequence (479 amino acids)
>PFLU_RS30010 cardiolipin synthase (Pseudomonas fluorescens SBW25) MDFFGPHLLAYFIATLHFLGTLAAIHAVLTVRTAQGSIAWALSLMFMPYLTLIPYLIFGR STFDAYIQARRQANQEMHTAITALNWRPWVEEALAARNSSAYASLRAMPKLGRMPCLANN EVHLLINGDATFSAIFEAIRNARTAVLFQFFIIHDDELGRQLHALLKEKSAEGVAIYVLY DRIGSHALPHRYVQSLRDAGVQVKAFATRSGWLNRFQVNFRNHRKIVVVDGITGFVGGHN VGDEYLGKKPPLAPWRDTHVQVTGPVVACLQESFAEDWFWAARELPPLILPDAYPEDGVL CQLLASGPADPYETCSLFFVEAIHAATERVWITSPYFIPDEAVFAALRLAVLRGVDVRLL LPSRPDHRIVYAASSLYAIEAVRAGVRVFRYTPGFLHQKVVLVDSEISAIGSANMDNRSF RLNFEVMLLTVDEAFAKEVEHMLLDDFALAHEVSQEESRETRRLQQLGMRVARLISPIL