Protein Info for PFLU_RS29770 in Pseudomonas fluorescens SBW25

Annotation: phosphate ABC transporter substrate-binding protein PstS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR02136: phosphate binding protein" amino acids 3 to 310 (308 residues), 324.6 bits, see alignment E=2.8e-101 PF12849: PBP_like_2" amino acids 38 to 296 (259 residues), 127.9 bits, see alignment E=6.4e-41 PF13531: SBP_bac_11" amino acids 48 to 307 (260 residues), 26 bits, see alignment E=7.5e-10

Best Hits

Swiss-Prot: 84% identical to PSTS_PSEAE: Phosphate-binding protein PstS (pstS) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 100% identity to pfs:PFLU6048)

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K4D5 at UniProt or InterPro

Protein Sequence (328 amino acids)

>PFLU_RS29770 phosphate ABC transporter substrate-binding protein PstS (Pseudomonas fluorescens SBW25)
MKLKRLMAAMTFVAAGVATANAVAAGVDPAIPAYVKTTGVSGNLSSVGSDTLANLMTLWA
EGYKKEYPNVNIQIQAAGSATAPPALTEGTSNLGPMSRKMKDTELAAFEQKYGYKPTAIP
VAVDALAVFVHKDNPIQHLTMEQVDAIFSSTRLCGAKADVKTWGDLGVTGDLANKPVQLF
GRNSVSGTYGYFKEEALCKGDYKPNVNEQPGSASVVQSISSSLNGIGYSGIGYKTASVKT
VALAKKGSTDFIEDTEENALNGKYPLSRFLYVYVNKAPNKPLAPLEAEFVKLVLSKQGQE
VVVKDGYIPLPAKVAAKALADLGLKEGN