Protein Info for PFLU_RS29685 in Pseudomonas fluorescens SBW25

Annotation: type IV secretion protein Rhs

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1100 1200 1300 1400 1456 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details PF05488: PAAR_motif" amino acids 175 to 219 (45 residues), 36.6 bits, see alignment (E = 1.1e-12) PF20148: DUF6531" amino acids 297 to 375 (79 residues), 71.5 bits, see alignment 1.5e-23 PF05593: RHS_repeat" amino acids 489 to 525 (37 residues), 27.9 bits, see alignment (E = 6.1e-10) amino acids 578 to 614 (37 residues), 22.4 bits, see alignment (E = 3.2e-08) amino acids 604 to 635 (32 residues), 30.1 bits, see alignment (E = 1.3e-10) amino acids 663 to 699 (37 residues), 38.9 bits, see alignment (E = 2.2e-13) amino acids 705 to 741 (37 residues), 26.6 bits, see alignment (E = 1.6e-09) amino acids 735 to 763 (29 residues), 31.3 bits, see alignment (E = 5.4e-11) amino acids 769 to 804 (36 residues), 22.1 bits, see alignment (E = 4.1e-08) amino acids 790 to 825 (36 residues), 27.7 bits, see alignment (E = 7.2e-10) amino acids 810 to 846 (37 residues), 27.1 bits, see alignment (E = 1.1e-09) amino acids 890 to 921 (32 residues), 24.8 bits, see alignment (E = 6e-09) TIGR01643: YD repeat (two copies)" amino acids 489 to 525 (37 residues), 18.6 bits, see alignment (E = 2.1e-07) amino acids 578 to 615 (38 residues), 30 bits, see alignment (E = 5.3e-11) amino acids 604 to 637 (34 residues), 27.4 bits, see alignment (E = 3.3e-10) amino acids 651 to 680 (30 residues), 17.8 bits, see alignment (E = 3.7e-07) amino acids 663 to 703 (41 residues), 32.7 bits, see alignment (E = 7.2e-12) amino acids 705 to 745 (41 residues), 27.4 bits, see alignment (E = 3.3e-10) amino acids 747 to 787 (41 residues), 26.2 bits, see alignment (E = 8e-10) amino acids 789 to 817 (29 residues), 19 bits, see alignment (E = 1.6e-07) amino acids 814 to 850 (37 residues), 24.9 bits, see alignment (E = 2.1e-09) amino acids 890 to 924 (35 residues), 22.6 bits, see alignment (E = 1.1e-08) amino acids 1121 to 1143 (23 residues), 17.3 bits, see alignment (E = 5.4e-07) amino acids 1145 to 1176 (32 residues), 22.2 bits, see alignment (E = 1.5e-08) PF03527: RHS" amino acids 1231 to 1267 (37 residues), 56.3 bits, see alignment (E = 5.4e-19) TIGR03696: RHS repeat-associated core domain" amino acids 1258 to 1336 (79 residues), 90.8 bits, see alignment 6.2e-30 PF15653: Tox-URI2" amino acids 1347 to 1427 (81 residues), 65 bits, see alignment 1.7e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU6030)

Predicted SEED Role

"Rhs-family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K4B8 at UniProt or InterPro

Protein Sequence (1456 amino acids)

>PFLU_RS29685 type IV secretion protein Rhs (Pseudomonas fluorescens SBW25)
MSDALWAARMGDALSHTSMMADILGGVLEVAANIAITAVATAAVVAATGITVATGGLGCF
LLGAVVGTIVGLAMSKTGADKGLTNLCDTFANALFPPTVQANILTGSTNTLTNNIPAARA
AGAISSHVAPAGTELEEPAPEPEASYLDMAESFFSQMWRPTVATPAPGAVPKPLDLVVCM
KHPPMPPQFLAEGSEKVTVNGQPAVRSGDRSTCDATVVSSGLISSNVTIGGGSVVVREIR
SGKTPGVGLAVTALLMLKGGKGKFFSKLPCMLIGGATSMAVSSAMGAMANAAMGSSNPVH
AATGAKVLGDVEELDFVLPGILPIEWQRFYNSRDERSGSLFGSGWSVQYEVCVEIRPHPE
GGETLIYTDEQGRPIDMGSIPLGGAVFSAGEGLAVRRHLNGQLLIESDDGLYRLFEPTPA
NPSLLRLSQLGDRNDNRIHIDYDEVGRLVRLRDTFDLVQVELIRDQDHLTQIERLYPDQR
REVLVSYGYDAAGNLAEVRDATGQVQRRFAYDTGRRMVEHQLPTGLRCFYEWALIEDLEW
RVVRHWTDEGDTYQFDYDLKVGLTRITDGLQRVSTRHWNTQHQIIQYSDNLGQTWRFEWN
DERQLLSATDPLGGRYEYSYDESGNLIGETDPLGRSDSTLWLEHWALPLVETDAADNSWA
YRYDQRGNCIAETDPLGYVTRYRYDDHGQVVEIIDATGKSKKLRWNPFGQLAEHIDCSGY
PTRFSYDKRGYLQVITDALGERTQFSYDAQGRLLSTQLPDGRTEHYQRDVSGQLAGYTDP
AGHTTLYQHNRRGQVRQRTDAHGRQVQFGYDSYGRLQALINENGERYRFAWDAGDRLTEQ
QDLDGSAKHYSYDPLDNVTAVTTVPAPYGNGLALVPETPPAPIIHRLERDAVGRLVAKTT
DDGRTDYSYDAVDQLTTVTFTDSQGNAQALGFAYDALGQLLCEQSSAGNLQHHYDELGNL
IQTQLPDGRWLNRLYYGSGHLHQVNLDGQVISDFERDRLHREVLRTQGQLSTRSEYDRSG
RLRSRQRRHASQSTLLPAAAQKQFEYDPADNLIGKLDQQPAAQHRQLLHYDATGRIIASQ
DSLHGQRETFAYDAAANLLDGPQAGAGLVVHNKLLTYQDKRYRYDAFGRMIEKRSAKRGV
QRFAYDAESRLVEVRSDNGSVVRMVYDPLGRRIEKTEHGSDGYPLGETRFVWDGLRLLQE
HKHSQTSLYVYDDDGYEPLARVDGLGPLQKIRYYHNDLNGLPEQLTEADGHAVWQATYRV
WGNTLEEVREPYYIEEQNLRFQGQYLDRETGLHFNTFRFYDPDVGRFTTPDPIGLDGELN
LYQYAPNPIAWIDPWGWKTCGAANGNSKQNNKMNHVYVIRNKTTGQVYKYGISGGKISKA
GKSYRAQSQVRWLNRKGSDKYESAIIRKNVTRSKALKVEQGRVNGYSVAAQRAGQTPSFP
KVGINPVGNSLPNATR