Protein Info for PFLU_RS29660 in Pseudomonas fluorescens SBW25

Annotation: type VI secretion system ATPase TssH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 887 TIGR03345: type VI secretion ATPase, ClpV1 family" amino acids 13 to 873 (861 residues), 1280.8 bits, see alignment E=0 PF13191: AAA_16" amino acids 211 to 312 (102 residues), 33.1 bits, see alignment E=3.9e-11 PF00004: AAA" amino acids 234 to 367 (134 residues), 36.4 bits, see alignment E=3.3e-12 amino acids 622 to 708 (87 residues), 27.7 bits, see alignment E=1.7e-09 PF17871: AAA_lid_9" amino acids 373 to 465 (93 residues), 102.7 bits, see alignment E=5e-33 PF07724: AAA_2" amino acids 616 to 782 (167 residues), 181.6 bits, see alignment E=6.2e-57 PF07728: AAA_5" amino acids 621 to 735 (115 residues), 35.4 bits, see alignment E=5.1e-12 PF10431: ClpB_D2-small" amino acids 789 to 863 (75 residues), 48.1 bits, see alignment E=4.9e-16

Best Hits

Swiss-Prot: 88% identical to CLPV1_PSEAE: Protein ClpV1 (clpV1) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K11907, type VI secretion system protein VasG (inferred from 100% identity to pfs:PFLU6025)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K4B3 at UniProt or InterPro

Protein Sequence (887 amino acids)

>PFLU_RS29660 type VI secretion system ATPase TssH (Pseudomonas fluorescens SBW25)
MGEISRAALFGKLNSVAYKAIEAATVFCKLRGNPYVELAHWFHQLLQLQDSDLHRIIRQF
NVEPARLARDLTEALDRLPRGSTSITDLSSHVEEAVERGWVYGSLMFGESQVRTGYLVLG
ILKTPSLRHALLGLSSEFDKIKAEALSERFDEYVGDSPENALSASDGFNAGAVPGEASGA
MAPSAMGKQEALKRFTVDLTEQARSGKLDPIVGRDEEIRQLVDILMRRRQNNPILTGEAG
VGKTAVVEGFALRIVAGDVPPALKDVELRSLDVGLLQAGASMKGEFEQRLRQVIEDVQAS
PKPIILFIDEAHTLVGAGGAAGTGDAANLLKPALARGTLRTVAATTWAEYKKHIEKDPAL
TRRFQVVQVAEPSEDKALLMMRGVASTMEKHHQVQILDEALEASVKLSHRYIPARQLPDK
SVSLLDTACARVAISLHAVPAEVDDSRRRIEALETELQIIAREHAIGIAIGARQTNSEAL
LSAERERLATLESRWAEEKALVDELLATRATLREKAGAVDSGDDALREQLVDLQQRLSAL
QGETPLILPTVDYQAVASVVADWTGIPVGRMARNELETVLNLDQHLKKRIIGQDHALQMI
AKRIQTSRAGLDNPSKPIGVFMLAGTSGVGKTETALALAEAMYGGEQNVITINMSEFQEA
HTVSTLKGAPPGYIGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVHEIFFQVFDKGVME
DGEGRVIDFKNTLILLTTNAGTELISQVCKDPANIPEPEEIAKALRQPLLEIFPPALLGR
LVTIPYYPLSDEMLKAITRLQLGRIKKRVETTHKVAFDYDDAVVDLIVSRCTETESGGRM
IDTILTNSLLPDMSREFLTRMLEGKAMAGVRISSRDNELHYDFSDAD