Protein Info for PFLU_RS29040 in Pseudomonas fluorescens SBW25

Annotation: thioredoxin TrxA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00085: Thioredoxin
  • amino acids 7 to 106 (100 residues), 119 bits, E=1.3e-38
• TIGR01068: thioredoxin
  • amino acids 10 to 108 (99 residues), 125.6 bits, E=3.8e-41
• PF13098: Thioredoxin_2
  • amino acids 22 to 105 (84 residues), 32.3 bits, E=1.6e-11

Best Hits

Swiss-Prot: 81% identical to THIO_PSEAE: Thioredoxin (trxA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03671, thioredoxin 1 (inferred from 100% identity to pfs:PFLU5901)

MetaCyc: 69% identical to reduced thioredoxin 1 (Escherichia coli K-12 substr. MG1655)
RXN-20161 [EC: 1.8.4.16]

Predicted SEED Role

"Thioredoxin" in subsystem Glycine reductase, sarcosine reductase and betaine reductase

MetaCyc Pathways

• periplasmic disulfide bond reduction (1/2 steps found)
• cytochrome c biogenesis (system I type) (7/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.16

Sequence Analysis Tools

See C3K3Z1 at UniProt or InterPro

Protein Sequence (109 amino acids)

>PFLU_RS29040 thioredoxin TrxA (Pseudomonas fluorescens SBW25)
MSNDLIKHVTDATFEAEVLKAAGPVLVDYWAEWCGPCKMIAPVLDDIATTYEGKLTIAKL
NIDDNQETPAKHGVRGIPTLMLFKNGNVEATKVGALSKSQLQAFLDANI