Protein Info for PFLU_RS28820 in Pseudomonas fluorescens SBW25

Annotation: aliphatic sulfonates ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 30 to 163 (134 residues), 103.2 bits, E=9.7e-34

Best Hits

Swiss-Prot: 91% identical to SSUB2_PSEF5: Aliphatic sulfonates import ATP-binding protein SsuB 2 (ssuB2) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 100% identity to pfs:PFLU5854)

MetaCyc: 74% identical to aliphatic sulfonate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-56-RXN [EC: 7.6.2.14]

Predicted SEED Role

"Alkanesulfonates ABC transporter ATP-binding protein / Sulfonate ABC transporter, ATP-binding subunit SsuB" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.14

Sequence Analysis Tools

See C3K3U6 at UniProt or InterPro

Protein Sequence (268 amino acids)

>PFLU_RS28820 aliphatic sulfonates ABC transporter ATP-binding protein (Pseudomonas fluorescens SBW25)
MTAQQPPRLLKGIPLAVRKLRKAFGAREVLKDIDLHIPAGQFVAVVGRSGCGKSTLLRLL
AGLDKASGGELLAGSAPLSEAIEDTRLMFQEARLLPWKKIIDNVGLGLKGNWRPKALEAL
EAVGLAERANEWPAALSGGQKQRVALARALIHQPRLLLLDEPLGALDALTRIEMQQLIEN
LWQKHGFTVLLVTHDVSEAVAIADRVILIEDGEIGLDLIVDLPRPRARGSHRLAALEAEV
LNRVLSLPGTPPEPEPVSPLPTQLRWAQ