Protein Info for PFLU_RS28570 in Pseudomonas fluorescens SBW25

Annotation: DUF2868 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 transmembrane" amino acids 72 to 94 (23 residues), see Phobius details amino acids 103 to 127 (25 residues), see Phobius details amino acids 170 to 196 (27 residues), see Phobius details amino acids 209 to 223 (15 residues), see Phobius details amino acids 255 to 280 (26 residues), see Phobius details PF11067: DUF2868" amino acids 145 to 442 (298 residues), 351.9 bits, see alignment E=1.9e-109

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU5804)

Predicted SEED Role

"probable integral membrane protein NMA1899"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K3P7 at UniProt or InterPro

Protein Sequence (459 amino acids)

>PFLU_RS28570 DUF2868 domain-containing protein (Pseudomonas fluorescens SBW25)
MTALNPLQKLWLTETVRLREEHAGNLEDLEANRLARTAGGDLPTRIQQRALHLAERDGLT
AALTRWLQGARLALVLLVIVAVISGAGLAFAALGNGLTPVNVFWALGSLLGLNLILLISW
ALGLMFAGEHSASLGRLWLWLSEKLARDAKAAQLAPALLLLLQRQKLNRWAVGVLVNSLW
LLALLSALVILLTLLATRRYGFVWETTILGADTFVAVTQALGTLPALLGFNVPTVEMIRA
SGDSALNIESARQAWAAWLVGVLLVYGLLPRLVLALLCLWRWKRGRAALRLDLNLPGYSQ
LRERLMPSSERLGVNDAAPEQLHHVSGGVSELESDGALVVAIELDDQHAWPPKLPASVKN
AGILDSRESRHKLLEQLTRFPPARLAIACDPRRSPDRGSLALIAELARSATATRVWLLQA
PSGQALDAERLGDWHAALQQLELPFADCAPLNWLESGHD