Protein Info for PFLU_RS28055 in Pseudomonas fluorescens SBW25

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 701 PF00072: Response_reg" amino acids 15 to 125 (111 residues), 88.8 bits, see alignment E=9.6e-29 TIGR00229: PAS domain S-box protein" amino acids 154 to 270 (117 residues), 31.4 bits, see alignment E=1.7e-11 PF00989: PAS" amino acids 154 to 246 (93 residues), 26.4 bits, see alignment E=2.1e-09 PF08448: PAS_4" amino acids 157 to 265 (109 residues), 32.8 bits, see alignment E=2.5e-11 PF13426: PAS_9" amino acids 162 to 263 (102 residues), 30.1 bits, see alignment E=1.7e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 271 to 434 (164 residues), 147 bits, see alignment E=4.2e-47 PF00990: GGDEF" amino acids 275 to 431 (157 residues), 147.2 bits, see alignment E=1.3e-46 PF00563: EAL" amino acids 451 to 686 (236 residues), 222.9 bits, see alignment E=1.4e-69

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU5698)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K3E5 at UniProt or InterPro

Protein Sequence (701 amino acids)

>PFLU_RS28055 EAL domain-containing protein (Pseudomonas fluorescens SBW25)
MDCAPHLGDGGSVLLVVDDYPENLVSMRALLQREDWQVVTAGSGVEALELLLKHDVDLVL
LDVKMPGMDGFEVARLMRGNQRTRMTPIIFLSANAQSPAAVLEGYASGAIDYLFKPFDPH
ILKPKVQALLEHQRNRRALQRLSHDLESARAFNASVLDNAAEGILVVSEEGVIEYANPAI
SRLLNATMDELQGQEFLSFLQKPHVPAWLESQMYAGYRDGETWRLHDAILRTGRGQQVPV
ALSCAPLPAEQKAMVVTVLDMSEVRHLHQQLEFQAVTDPLTGLLNRRGFYQAVENTLLRS
ERVEQSLVLLYLDLDGFKRVNDSLGHDAGDRVLRWVSEQLQGCLRSYDILGRMGGDEFTA
LLELEFPEQAAKIAEKLIERVSICQQVEGLDVMLGVSIGIATFPDCGSDLNGLLRAADIA
MYEAKRAGRQQYRYYDQEMNGRARSRLMLEDSVRTAIQNKDFTLVYQPQVSLADGRLRGV
EALLRWQHPSVGDVPPGLFLPLLEEARLISQLSSWIYQQVAAQRLAWQATFDQELVLSVS
LSSHQFNMPNLAAQLQQVFERHGLQGRQLEVEISEDSLTSNLEESGKQLKLLRQIGVRIA
LDDFGSGNCSLAHLRDLAFDTLKLDPQLIARLPGSARDAVMARSIIELCGHFDVLVVAEG
VETSEQAQWLKANGCAYIQGPWAAQPMVAEDVVDWSRARVR