Protein Info for PFLU_RS27610 in Pseudomonas fluorescens SBW25

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 589 transmembrane" amino acids 514 to 532 (19 residues), see Phobius details PF12418: AcylCoA_DH_N" amino acids 4 to 29 (26 residues), 26.3 bits, see alignment (E = 1.9e-09) PF02771: Acyl-CoA_dh_N" amino acids 41 to 157 (117 residues), 49 bits, see alignment E=2.3e-16 PF02770: Acyl-CoA_dh_M" amino acids 162 to 266 (105 residues), 48 bits, see alignment E=3.4e-16 PF00441: Acyl-CoA_dh_1" amino acids 277 to 445 (169 residues), 82.7 bits, see alignment E=9.6e-27 PF22924: ACOX_C_alpha1" amino acids 302 to 441 (140 residues), 31.7 bits, see alignment E=3.8e-11 PF12806: Acyl-CoA_dh_C" amino acids 464 to 583 (120 residues), 120.4 bits, see alignment E=1.5e-38

Best Hits

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 100% identity to pfs:PFLU5607)

Predicted SEED Role

"Acyl-CoA dehydrogenase (EC 1.3.8.7)" (EC 1.3.8.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.7, 1.3.99.-

Use Curated BLAST to search for 1.3.8.7 or 1.3.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K356 at UniProt or InterPro

Protein Sequence (589 amino acids)

>PFLU_RS27610 acyl-CoA dehydrogenase (Pseudomonas fluorescens SBW25)
MPEYKAPLRDMRFLIDNVFDFHGHYAALGATDASPDMVGAILEEGAKFCENVLAPLNRSG
DEEGCHFDNGVVTTPKGFKEAFAQYVEGGWHGVAADPAYGGQGLPQSLGLVLSEMIGSSN
TSWGMYPGLTHGAMSAIHAHGTAEQKDTYLSKLTAGEWTGTMCLTEAHCGTDLGLIKTRA
VPQADGSYAVTGSKIFISAGEHDMSVNIIHLVLAKLPDAPAGTKGISLFIVPKFHADSGE
RNAVHCGSIEHKMGIKGSATCVLNFDGAKGFLIGEANKGLNCMFTMMNHARLGTGMQGLC
NGEASFQGAIKYANDRLQMRSLTGAKAPEKAADPIIVHPDVRRMLLTMKAFNEGNRALTY
FTAQLLDTAHLSSDATQRQDAEDLLAFLTPICKAFMTDTGLEVTNHGMQVFGGHGYIREW
GMEQLARDARIAPIYEGTNGIQALDLLGRKVLGSQGKLLRGFTRIVHKFCGANAEHPQLK
AYVAQLNQLNGEWGELTTQVGMAAMKNPDEVGAAAVDYLMYSGYVILAYLWLRMAIAALE
QQDTDFAKAKLATCDFYFKRLLPRTASHRVAVQAGSECLMSLPAEAFAL