Protein Info for PFLU_RS26980 in Pseudomonas fluorescens SBW25

Annotation: UPF0104 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 16 to 33 (18 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 128 to 152 (25 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 205 to 229 (25 residues), see Phobius details amino acids 237 to 268 (32 residues), see Phobius details amino acids 278 to 303 (26 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 22 to 296 (275 residues), 38 bits, see alignment E=7.1e-14

Best Hits

Swiss-Prot: 47% identical to YBHN_ECOLI: Inner membrane protein YbhN (ybhN) from Escherichia coli (strain K12)

KEGG orthology group: K07027, (no description) (inferred from 100% identity to pfs:PFLU5489)

Predicted SEED Role

"Inner membrane protein YbhQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K2T8 at UniProt or InterPro

Protein Sequence (318 amino acids)

>PFLU_RS26980 UPF0104 family protein (Pseudomonas fluorescens SBW25)
MTSETKGSRFKRWKKPLTIAFFLLLIVLFTMLARRIDWSEVVQTLGDFKLRTLVIAGTLT
LCSFLVYASFDLIGRTYIRQPLVWKQILPVGIISYAFNLNLSAWVGGIAMRYRLYSRLGV
SNSNIAKILGLSLATNWFGYMAIAGVIFSSGLVTMPPGWKVSTLALQGIGAVLVLVSLGY
LAACQYSKKRAWTIRGMEINLPSLRMACLQLMLGALNWSLMAAVIFTLLPAKLDYPLVLG
VLLISAIAGVLTHIPAGLGVLEAVFIALLQHEASRGSLLAGLIAYRAIYFIVPLLIALVM
YLGVEAKAKALRVKKTPA