Protein Info for PFLU_RS26875 in Pseudomonas fluorescens SBW25

Annotation: thiamine-phosphate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01379: thiamine-phosphate kinase
  • amino acids 2 to 317 (316 residues), 307.3 bits, E=5.4e-96
• PF00586: AIRS
  • amino acids 28 to 138 (111 residues), 107.2 bits, E=6.4e-35
• PF02769: AIRS_C
  • amino acids 150 to 299 (150 residues), 26.5 bits, E=6.7e-10

Best Hits

KEGG orthology group: K00946, thiamine-monophosphate kinase [EC: 2.7.4.16] (inferred from 100% identity to pfs:PFLU5468)

Predicted SEED Role

"Thiamine-monophosphate kinase (EC 2.7.4.16)" in subsystem Thiamin biosynthesis (EC 2.7.4.16)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• superpathway of thiamine diphosphate biosynthesis I (8/10 steps found)
• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• thiamine diphosphate salvage II (4/5 steps found)
• thiamine diphosphate salvage V (2/3 steps found)
• thiamine diphosphate salvage I (1/2 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.16

Sequence Analysis Tools

See C3K2R7 at UniProt or InterPro

Protein Sequence (321 amino acids)

>PFLU_RS26875 thiamine-phosphate kinase (Pseudomonas fluorescens SBW25)
MGEFELIRNYFAAAPCAQGGEGIALGIGDDCALLALPTGEQLAISTDTLVAGVHFADPCD
PFLLGQRSLAVAVSDLAAMGAHPLAFTLALTTPTVDADWLQRYAQGLNAMAQRCGVGLVG
GDTTRGPLSLTLTVLGRVPAGQALTRSGARPGDLLCVGGELGNAAGALPLVLGQRSADAA
IADPLLAHYWSPQPQLALGLALRGKATSAMDISDGLLADCGHIATASQVSLLIERQRLPL
STALLAFVGDDEARVAALSGGDDYVLAFTLPPAELAPLLADGLPIHVIGRVEPGQGVTLL
DADGQDITPAIRGYQHFREAP