Protein Info for PFLU_RS26855 in Pseudomonas fluorescens SBW25
Annotation: cobalamin-binding protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 32% identical to BTUF_VIBC3: Vitamin B12-binding protein (btuF) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
KEGG orthology group: None (inferred from 100% identity to pfs:PFLU5464)Predicted SEED Role
"Vitamin B12 ABC transporter, B12-binding component BtuF" in subsystem Coenzyme B12 biosynthesis
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See C3K2R3 at UniProt or InterPro
Protein Sequence (262 amino acids)
>PFLU_RS26855 cobalamin-binding protein (Pseudomonas fluorescens SBW25) MRCHWLAVVLLAFSAQALAIERVVSLAPSLSEIVVELGAADLLVGVLDGGERPAALAQVP SVGHYGQLDMERLLSLKPDLILLWPGSVGPAQREQLQRLNIPVYVAEPHSLEQLTTQVQA IAEQLDRPEAGRQLAAQLRQRLAELRQRYQRAEPLRVFYQVWNQPLYTVGGGQIISDALT VCGARNVFDDLKLPAPQVNIESVLQRNPEMILVGDQAQQEAWKVWPTMAARVRLVPDKGL ERPSGQMLEAVGRLCQVIAPNL