Protein Info for PFLU_RS26645 in Pseudomonas fluorescens SBW25

Annotation: lytic murein transglycosylase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13406: SLT_2
  • amino acids 36 to 327 (292 residues), 354.2 bits, E=2.7e-110
• TIGR02282: lytic murein transglycosylase B
  • amino acids 40 to 328 (289 residues), 400.2 bits, E=2.4e-124

Best Hits

KEGG orthology group: K08305, membrane-bound lytic murein transglycosylase B [EC: 3.2.1.-] (inferred from 100% identity to pfs:PFLU5421)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

See C3K2M3 at UniProt or InterPro

Protein Sequence (336 amino acids)

>PFLU_RS26645 lytic murein transglycosylase B (Pseudomonas fluorescens SBW25)
MQVMRGWATRHASWMGLIGLLGATQEAQAGDYDGSPQVAEFVGEMTRDYGFAGEQLMGVF
REAQKKQAILDAISRPAERVKQWKEYRPMFLTDARVARGVDFWRQHEAVLARAEQEYGVP
AQVIVAIIGIETFYGRNTGSYRVIDALSTLGFDYPPRADFFRKELREFLLLAREEQVDPL
TLKGSYAGAMGLPQFMPSSFRAYAVDFDGDGHINIWSNPDDAIGSVASYFKRHGWVGGEP
VVIRADVTGDRADEGLTQGIEPAKTVGELRALGWSSQNALPDDMPVTAFRLDGENGPEYW
MGLKNFYAITRYNRSVMYAMAVHQLSDMLVQARGNK