Protein Info for PFLU_RS26500 in Pseudomonas fluorescens SBW25

Annotation: Lrp/AsnC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 PF13404: HTH_AsnC-type" amino acids 4 to 45 (42 residues), 66.6 bits, see alignment E=4.8e-22 PF13412: HTH_24" amino acids 4 to 50 (47 residues), 78.1 bits, see alignment E=1e-25 PF12802: MarR_2" amino acids 8 to 55 (48 residues), 30.6 bits, see alignment E=1e-10 PF01047: MarR" amino acids 9 to 53 (45 residues), 35.5 bits, see alignment E=2.7e-12 PF13545: HTH_Crp_2" amino acids 18 to 62 (45 residues), 29.9 bits, see alignment E=1.6e-10 PF01037: AsnC_trans_reg" amino acids 70 to 145 (76 residues), 78.8 bits, see alignment E=8e-26

Best Hits

Swiss-Prot: 48% identical to LRP_SALTY: Leucine-responsive regulatory protein (lrp) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a4933)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K2J5 at UniProt or InterPro

Protein Sequence (159 amino acids)

>PFLU_RS26500 Lrp/AsnC family transcriptional regulator (Pseudomonas fluorescens SBW25)
MSKLDRYDLSILAELQRDARISNQELAERIGLSPSPCSRRVKQLEDDGYISRQVALLDRK
MLGLSLTAYVLIGMDRHTPERFENFEAAIRTLPQVLECSLVTGMDADYQLKVVVPDMDHY
QKLLLGHLTRIEGVTSVRSSFVLNQVLNSTELPLTHLRT