Protein Info for PFLU_RS26470 in Pseudomonas fluorescens SBW25

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 51 to 73 (23 residues), see Phobius details amino acids 85 to 109 (25 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details PF06790: UPF0259" amino acids 85 to 211 (127 residues), 34.5 bits, see alignment E=1e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU5387)

Predicted SEED Role

"FIG00958173: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K2I9 at UniProt or InterPro

Protein Sequence (219 amino acids)

>PFLU_RS26470 membrane protein (Pseudomonas fluorescens SBW25)
MNPLDVLRDSFRFTQRNLGAIVQLCLPLVIFEALLQQVLNHVVGPDAFPGYSVVVGLLVY
PLYTGALILFLDARTRGESPRTKDIWAMALTLWPRFALLTAMSTLLILLGLSLYFLPGLW
LMVVLAFAEYLLVLRGMPALEAMKESFRLSRGHFWMILVCLLCVMTPLWLLKGASVAAYP
EPAPLLGLLLDSAHSFLQLFTSVVLFRLFMLIGGDADAR