Protein Info for PFLU_RS26330 in Pseudomonas fluorescens SBW25

Annotation: type I secretion system permease/ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 578 transmembrane" amino acids 19 to 42 (24 residues), see Phobius details amino acids 54 to 76 (23 residues), see Phobius details amino acids 140 to 171 (32 residues), see Phobius details amino acids 248 to 277 (30 residues), see Phobius details TIGR01842: type I secretion system ATPase" amino acids 12 to 552 (541 residues), 782 bits, see alignment E=1.5e-239 PF00664: ABC_membrane" amino acids 20 to 279 (260 residues), 49.4 bits, see alignment E=5.4e-17 PF00005: ABC_tran" amino acids 346 to 492 (147 residues), 102.6 bits, see alignment E=2.8e-33

Best Hits

Swiss-Prot: 64% identical to APRD_PSEAE: Alkaline protease secretion ATP-binding protein AprD (aprD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K12536, ATP-binding cassette, subfamily C, bacterial HasD (inferred from 100% identity to pfs:PFLU5358)

Predicted SEED Role

"ABC exporter for hemopore HasA, ATP-binding component HasD" in subsystem Protein secretion by ABC-type exporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K2G1 at UniProt or InterPro

Protein Sequence (578 amino acids)

>PFLU_RS26330 type I secretion system permease/ATPase (Pseudomonas fluorescens SBW25)
MRHAGNETLAALTAYKSGFFNIGLFSAVINLLMLAPALYMLQVYDRVLASGNQMTLLMLT
LMILGLFGLMGALEWVRSQVVIRLGTQMDMRLNQRVYDAAFEAQLKGGTQAAGQALHDLT
TLRQFATGQALFAFFDAPWFPVYLLVIFLFHPWLGLLALVGALLLMALAWVNHHVSQAPM
ALASQLSISASQQATANLRNADTIEAMGMLGTLRARWFGQHQAFLAQQNLASEKTAAVSA
WSKGVRLALQSLVLGLGALLAVQGDITPGMMIAGSILMGRVLTPIDQLIGVWKQWGSARL
AYERLSQMLEANPARPVPMSLPVPKGQLSVEHISACAPGSRRPALANLGFNLAAGDVLGV
IGPSGCGKSTLARILVGAWAPLAGKVRLDGADLALWDKQQLGPHIGYLPQDIQLFAGSIA
ENIARFAEVDADKVLAAAQMAGVHELILQLPQGYDTPLGEGGAGLSGGQKQRVALARALY
GLPALIVLDEPNANLDEVGEHALLQAIGQLKQQRRTVILITHKPNVLSLTDQLLILKDGQ
LQAFGPTARVLEARQKPAASKPVSTLSMSYRLGEGKQA