Protein Info for PFLU_RS26300 in Pseudomonas fluorescens SBW25

Annotation: NCS2 family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 19 to 39 (21 residues), see Phobius details amino acids 49 to 74 (26 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details amino acids 195 to 217 (23 residues), see Phobius details amino acids 238 to 261 (24 residues), see Phobius details amino acids 282 to 304 (23 residues), see Phobius details amino acids 316 to 333 (18 residues), see Phobius details amino acids 341 to 361 (21 residues), see Phobius details amino acids 375 to 400 (26 residues), see Phobius details amino acids 411 to 429 (19 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 17 to 391 (375 residues), 193.2 bits, see alignment E=3e-61

Best Hits

Swiss-Prot: 53% identical to Y326_METJA: Putative permease MJ0326 (MJ0326) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 100% identity to pfs:PFLU5352)

MetaCyc: 51% identical to adenine:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-447

Predicted SEED Role

"Xanthine/uracil/thiamine/ascorbate permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K2F5 at UniProt or InterPro

Protein Sequence (431 amino acids)

>PFLU_RS26300 NCS2 family permease (Pseudomonas fluorescens SBW25)
MLEKLFQLKAHNTNVRTEILAGITTFLAMAYILFVNPSILGETGMDKGAVFVATCLAAAI
GSTVMGLIANYPIALAPGMGLNAFFTYTVVLHMGHTWQVALGAVFISAVLFFLLSIFRIR
EWIINAIPLPLRSAIAAGIGLFLALIALHNAGIVVSNPATMVGLGDLKQPAPILATLGFV
LIVALEALAVRGAVLIGILAVTIASIVLGFTPFIGITSAPPSLAPTFLQLDIKGALDIGL
VSVIFAFLFVDLFDNSGTLIGVAKRAGLMGKDGHMPKMGRALIADSTAAMAGSLLGTSTT
TSYIESAAGVSAGGRTGLTAIVVAILFLLALFFSPLAASVPAYATAPALLFVAVLMTQGL
AEIDWDDITVAAPVVVTALAMPFTYSIANGIAFGFIAWTAIKLLSGRYRELNPALVILSI
LFVIKLGWFNA