Protein Info for PFLU_RS26290 in Pseudomonas fluorescens SBW25

Annotation: 2Fe-2S iron-sulfur cluster binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 PF00111: Fer2" amino acids 21 to 68 (48 residues), 32.2 bits, see alignment E=8.1e-12 PF01799: Fer2_2" amino acids 88 to 160 (73 residues), 107 bits, see alignment E=4.3e-35

Best Hits

Swiss-Prot: 45% identical to DCMS_HYDPS: Carbon monoxide dehydrogenase small chain (cutS) from Hydrogenophaga pseudoflava

KEGG orthology group: K13483, xanthine dehydrogenase YagT iron-sulfur-binding subunit (inferred from 100% identity to pfs:PFLU5350)

MetaCyc: 46% identical to 1-testosterone hydratase/dehydrogenase gamma subunit (Steroidobacter denitrificans)
RXN-21494 [EC: 1.17.99.11]; 1.17.99.11 [EC: 1.17.99.11]; 1.17.99.11 [EC: 1.17.99.11]

Predicted SEED Role

"Periplasmic aromatic aldehyde oxidoreductase, iron-sulfur subunit YagT"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.99.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K2F3 at UniProt or InterPro

Protein Sequence (168 amino acids)

>PFLU_RS26290 2Fe-2S iron-sulfur cluster binding domain-containing protein (Pseudomonas fluorescens SBW25)
MSATPNGAAAQPFVSHPIRLRLNGQDRQLDVLPWTTLLDLLREQLDLVGSKKGCDHGQCG
ACTVLRDGKRVNACLTLAVMCDGAELTTIEGLADGDVLHPMQQAFIKHDAFQCGYCTPGQ
ICSAVGLVNEGRAHDTAQIQELMSGNLCRCGAYSNIRDAIVDVVGGEQ