Protein Info for PFLU_RS25865 in Pseudomonas fluorescens SBW25

Annotation: YhbY family RNA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 102 PF01985: CRS1_YhbY" amino acids 3 to 86 (84 residues), 88.3 bits, see alignment E=1.7e-29

Best Hits

Swiss-Prot: 71% identical to Y4753_PSEAE: Probable RNA-binding protein PA4753 (PA4753) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07574, RNA-binding protein (inferred from 100% identity to pfs:PFLU5262)

Predicted SEED Role

"FIG004454: RNA binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K268 at UniProt or InterPro

Protein Sequence (102 amino acids)

>PFLU_RS25865 YhbY family RNA-binding protein (Pseudomonas fluorescens SBW25)
MPLTQEQKKQYKSIGHHLKPVLIVADNGLTEGVLAEFERALNDHELIKIKVNILDREARL
AAIAELCKVGKADLVQVIGKMALLYRKNFSVNKQLSNVHRFK