Protein Info for PFLU_RS25740 in Pseudomonas fluorescens SBW25

Annotation: polynucleotide adenylyltransferase PcnB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 308 to 321 (14 residues), see Phobius details TIGR01942: poly(A) polymerase" amino acids 25 to 461 (437 residues), 635.7 bits, see alignment E=1.7e-195 PF01743: PolyA_pol" amino acids 56 to 189 (134 residues), 138.7 bits, see alignment E=2e-44 PF12627: PolyA_pol_RNAbd" amino acids 216 to 278 (63 residues), 72.8 bits, see alignment E=2.3e-24 PF12626: PolyA_pol_arg_C" amino acids 332 to 450 (119 residues), 149.4 bits, see alignment E=6.7e-48

Best Hits

KEGG orthology group: K00970, poly(A) polymerase [EC: 2.7.7.19] (inferred from 100% identity to pfs:PFLU5239)

Predicted SEED Role

"Poly(A) polymerase (EC 2.7.7.19)" in subsystem Polyadenylation bacterial (EC 2.7.7.19)

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.19

Use Curated BLAST to search for 2.7.7.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K245 at UniProt or InterPro

Protein Sequence (467 amino acids)

>PFLU_RS25740 polynucleotide adenylyltransferase PcnB (Pseudomonas fluorescens SBW25)
MLKKLFQSFRSPLRRTQHKRSTPEVLNSSQHSLQRAQFSRYAVNIVERLQNAGYQAYLVG
GCVRDMLLNITPKDFDVATSATPEQVRAEFRNARIIGRRFKLVHIHFGREIIEVATFRAG
HPQNDEEEDTNQSSRNESGRILRDNVYGTLEEDAQRRDFTINALYYDPVSERILDYANGV
HDIRNNLIRLIGDPVQRYQEDPVRMLRAVRFAAKLNFGIEKHTAAPIRELAPMLREIPSA
RLFEEVLKLFLSGYAADTFEMLVDLQLFDPLFPASAEALEYNPTYTHTLISEALINTDLR
IKQNKPVTPAFLFAALLWPALPKRVLRLQDRGMPPIPAMQEAAHELIAEQCQRIAIPKRF
TMPIREIWDMQERLPRRSGKRADLLLDNPRFRAGYDFLLLRESAGEQTDGLGEWWTDYQD
ANDSERRDMIRDLGSKGDGEGAGPKKRRRSGTKRKRSAADASGAAGE