Protein Info for PFLU_RS25685 in Pseudomonas fluorescens SBW25

Annotation: heme ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF00005: ABC_tran" amino acids 18 to 167 (150 residues), 93.4 bits, see alignment E=1e-30

Best Hits

Swiss-Prot: 83% identical to HMUV_PSEPF: Hemin import ATP-binding protein HmuV (hmuV) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 100% identity to pfs:PFLU5227)

Predicted SEED Role

"ABC-type hemin transport system, ATPase component" in subsystem Hemin transport system

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.34

Use Curated BLAST to search for 3.6.3.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K234 at UniProt or InterPro

Protein Sequence (255 amino acids)

>PFLU_RS25685 heme ABC transporter ATP-binding protein (Pseudomonas fluorescens SBW25)
MLRVEDLQIRRGRTTVLAGVTLDLLPGEVLGVLGPNGAGKSTLLGGLCGELPPDHGKVWL
DQRPLSEWSGAQRAQRLAVLPQSSTLDFAFRVEEVVGMGRLPHQTGRVRDDAIIEAALQA
ADVGHLSGRSYLALSGGERQRVHLARVLAQLWPGEAGQTLLLDEPTSMLDPLHQHTTLQA
IRTFADRGAAVLVILHDLNLAARYCDRILLLEAGRPHVLGAPAQVMQPAPLKAVFGLDVL
VQPHPERGHPLIIAR