Protein Info for PFLU_RS25240 in Pseudomonas fluorescens SBW25

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 118 to 136 (19 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 243 to 260 (18 residues), see Phobius details amino acids 266 to 285 (20 residues), see Phobius details PF00892: EamA" amino acids 5 to 134 (130 residues), 49.5 bits, see alignment E=2.5e-17 amino acids 150 to 285 (136 residues), 44.2 bits, see alignment E=1.1e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU5144)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K1V1 at UniProt or InterPro

Protein Sequence (300 amino acids)

>PFLU_RS25240 DMT family transporter (Pseudomonas fluorescens SBW25)
MNLSLYLLTVLIWGTTWIALKWQLGVVAIPVSIVYRFGLAALVLFALLLLSRKLQVMNRR
GHLICVAQGLCLFCVNFMCFLTASQWIPSGLVAVVFSTATLWNALNARVFFGQRVARNVL
MGGGLGLAGLGLLFWPEVVGHTASPQTLLGLGLALLGTMCFSAGNMLSSLQQKAGLRPLT
TNAWGMAYGAAMLATYCAVRGIPFEMDWSARYVGALWYLVIPGSVIGFTAYLTLVGRMGP
ERAAYCTVLFPVVALNVSAFAEGYQWTAPALAGLVLVMVGNVLVFRKPKVTSPVFEAKAV