Protein Info for PFLU_RS25235 in Pseudomonas fluorescens SBW25

Annotation: nitric oxide reductase transcriptional regulator NorR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF13185: GAF_2" amino acids 25 to 160 (136 residues), 29.5 bits, see alignment E=3.3e-10 PF01590: GAF" amino acids 25 to 159 (135 residues), 47.6 bits, see alignment E=1e-15 PF00158: Sigma54_activat" amino acids 194 to 360 (167 residues), 233.1 bits, see alignment E=5.9e-73 PF14532: Sigma54_activ_2" amino acids 195 to 365 (171 residues), 72 bits, see alignment E=2.5e-23 PF07728: AAA_5" amino acids 218 to 336 (119 residues), 32.1 bits, see alignment E=4.3e-11 PF00004: AAA" amino acids 218 to 340 (123 residues), 25.4 bits, see alignment E=6.9e-09 PF02954: HTH_8" amino acids 476 to 506 (31 residues), 25 bits, see alignment (E = 5e-09)

Best Hits

KEGG orthology group: K12266, anaerobic nitric oxide reductase transcription regulator (inferred from 100% identity to pfs:PFLU5143)

Predicted SEED Role

"Anaerobic nitric oxide reductase transcription regulator NorR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K1V0 at UniProt or InterPro

Protein Sequence (514 amino acids)

>PFLU_RS25235 nitric oxide reductase transcriptional regulator NorR (Pseudomonas fluorescens SBW25)
MTAKSLLTTLLPLVADLSRELPEGERYRRLLQAMRALLPCDAAALLRLDGDSLVPLAVDG
LSADTLGRRFKVSEHPRFAVLLSSPGPTRFDSDSELPDPYDGLVDGLHGHLEVHDCMGCP
LFVDDHPWGLLTLDALDTERFERVELDALQAFASLAAATVNVAERIERLALRAEDEHQRA
EIYRQASGQQHKEMIGQSKTHKRLVEEIKWVGGSDLTVLITGETGVGKELVAQAIHAASH
RADKPLISLNCAALPETLVESELFGHVRGAFTGALNERRGKFELANGGTLFLDEVGELSL
TVQAKLLRVLQSGQLQRLGSDKEHQVDVRLIAATNRDLADEVRNGRYRADFYHRLSVYPL
QVPALRERGRDVLLLAGFFLEQNRSRMGLGSLRLTSDAQAALLAYNWPGNVRELEHLIGR
SALKALGNCRERPKILSLSAQDLDLPDVSAPVVEAPVDTGLAVTGDLRQATEHYQRQVIS
ACLERHQHNWASAARELGLDRANLGRMAKRLGMK