Protein Info for PFLU_RS25210 in Pseudomonas fluorescens SBW25

Annotation: cytochrome o ubiquinol oxidase subunit III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details amino acids 102 to 119 (18 residues), see Phobius details amino acids 139 to 163 (25 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details TIGR02842: cytochrome o ubiquinol oxidase, subunit III" amino acids 29 to 207 (179 residues), 286.9 bits, see alignment E=4.3e-90 PF00510: COX3" amino acids 30 to 206 (177 residues), 60.6 bits, see alignment E=1.1e-20

Best Hits

Swiss-Prot: 77% identical to CYOC_PSEPU: Cytochrome bo(3) ubiquinol oxidase subunit 3 (cyoC) from Pseudomonas putida

KEGG orthology group: K02299, cytochrome o ubiquinol oxidase subunit III [EC: 1.10.3.-] (inferred from 100% identity to pfs:PFLU5138)

MetaCyc: 78% identical to cytochrome bo terminal oxidase subunit III (Pseudomonas putida KT2440)
RXN0-5268 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit III (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K1U5 at UniProt or InterPro

Protein Sequence (208 amino acids)

>PFLU_RS25210 cytochrome o ubiquinol oxidase subunit III (Pseudomonas fluorescens SBW25)
MSNLVTNAGHAHVDDHGHDDHHHDSGPMTVFGFWLYLMTDCILFASIFAVYAVLVNNVAG
GPSGHDIFELPYVLGETALLLFSSITYGFAMLAFYKGNKKGVLSWLALTFLFGLGFIGME
INEFHLLISEGYGPHRSGFLSAFFTLVGTHGLHVTAGLLWMAVMMYQVNKHGLTNTNKTR
LSCLSLFWHFLDVVWICVFTVVYLMGTL