Protein Info for PFLU_RS25110 in Pseudomonas fluorescens SBW25

Annotation: LTA synthase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 673 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 140 to 164 (25 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details PF00884: Sulfatase" amino acids 288 to 575 (288 residues), 147.6 bits, see alignment E=2.6e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU5116)

Predicted SEED Role

"Sulfatase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K1S5 at UniProt or InterPro

Protein Sequence (673 amino acids)

>PFLU_RS25110 LTA synthase family protein (Pseudomonas fluorescens SBW25)
MSALQSRRLRYGVGAIGLVFALLAALRLVFVLGFSGLDLSTPALLETLGIGLRFDLRLAV
LLLLPLALLAWIPRWNLTTLPALRWLARAYLVVALAVVGLVYIVDFGHYAYLGVRINATV
LRYLQDAQISQQMVWETYPVLWITACWLAAVALWVWALVCLERLTLDRAPSTRGKLSLVT
VSVIGVIGVLLALLGRVAHLNLENPVPLRWSDAFFSGNPQVAAVGLNPVLFLYDTLKVGQ
SQFDEVQVREHYPQVAHYLGVDRPDAQQLNFMREQGVQPYRLAGERAPNVIFVMLESLGT
SAVGAYGNPLNPTPNLDKLATQSWFFKHFYVPVTGTAKTVWASITGVPDVTRQETATRNP
LITRQHTLINAFEGYQKFYMIGGNAGWANINALIRQSIDGVQMFEESHWRSPRVDVWGIS
DLDLFKEGDELLRAVPKDQPFFAYLQTSGNHRPFTIPKHNDGFQVRDVTLEQAQAAGSRS
VEQYNAVRLLDYNIGRLMEIAKAGGYYDNSIFVFFGDHNTRISQIPHMAPAFEQLGLESN
NVPLLIHAPGLQPRVIEEAVGLADLLPTVAGLAGVPFSHGTMGRDIQQPAPEGERMVPLV
LREGTFPVIGGVTRHFLLQMQHDGSSPTLHDLASPTPRDDVAALHPDEFKRLQGLTRGLH
ESARLMLFRNVRE