Protein Info for PFLU_RS25030 in Pseudomonas fluorescens SBW25

Annotation: LysE family translocator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 69 (29 residues), see Phobius details amino acids 75 to 92 (18 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 155 to 181 (27 residues), see Phobius details amino acids 189 to 207 (19 residues), see Phobius details PF01810: LysE" amino acids 17 to 208 (192 residues), 114.5 bits, see alignment E=2.2e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU5101)

Predicted SEED Role

"Putative threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K1R0 at UniProt or InterPro

Protein Sequence (211 amino acids)

>PFLU_RS25030 LysE family translocator (Pseudomonas fluorescens SBW25)
MPEVSSWLAYALISLGMVLTPGPNMIYLISRSICQGRTAGLISLGGVALGFLVYMLCAAL
GITALVMAVPFAYDALRFGGALYLAYMAWQAIRPGGRSPFQVRDLPKDSPRKLFTMGLVT
NLLNPKVAVMYLSLLPQFIDPNGHGSVLMQSLVLGFTQIFISVSVNAVIATMAGSIAVFF
VTRPGWQVVQRWLMGSVLMGLAVRMAVEGRR