Protein Info for PFLU_RS24975 in Pseudomonas fluorescens SBW25

Annotation: SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF03705: CheR_N" amino acids 11 to 61 (51 residues), 49.9 bits, see alignment 4e-17 PF01739: CheR" amino acids 77 to 261 (185 residues), 185.5 bits, see alignment E=1.6e-58

Best Hits

Swiss-Prot: 40% identical to CHER_KLEAK: Chemotaxis protein methyltransferase (cheR) from Klebsiella aerogenes (strain ATCC 13048 / DSM 30053 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006)

KEGG orthology group: K00575, chemotaxis protein methyltransferase CheR [EC: 2.1.1.80] (inferred from 100% identity to pfs:PFLU5090)

Predicted SEED Role

"Chemotaxis protein methyltransferase CheR (EC 2.1.1.80)" in subsystem Bacterial Chemotaxis (EC 2.1.1.80)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.80

Use Curated BLAST to search for 2.1.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K1P9 at UniProt or InterPro

Protein Sequence (269 amino acids)

>PFLU_RS24975 SAM-dependent methyltransferase (Pseudomonas fluorescens SBW25)
MSDTVSIDDREFGQFQAWLYRAAGINLSPAKKALVAGRLFKRLKHYELQSYGEYFKLIMN
DQRKGELQVALDLLTTNETYFFREPKHFDFLRQHVLPQAAPGRMFRVWSAASSTGEEPYS
LAMTLAESLGTTPWEVIGSDISSQVLAKARTGHYSMERIETLPQPLLVKYCLKGIGRQEG
TVLIDKALRSRVNFVQVNLNEALPVLGEFEVIFLRNVMIYFDQQTKSQVVARLLPLLKPG
GYLIISHSESLHGVNDTLKLVAPSIYRKP