Protein Info for PFLU_RS24690 in Pseudomonas fluorescens SBW25

Annotation: membrane-bound lytic murein transglycosylase MltF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF00497: SBP_bac_3" amino acids 43 to 266 (224 residues), 118 bits, see alignment E=4.7e-38 PF01464: SLT" amino acids 293 to 400 (108 residues), 85.3 bits, see alignment E=2.5e-28

Best Hits

Swiss-Prot: 90% identical to MLTF_PSEF5: Membrane-bound lytic murein transglycosylase F (mltF) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU5035)

Predicted SEED Role

"Transglycosylase, Slt family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K1J3 at UniProt or InterPro

Protein Sequence (486 amino acids)

>PFLU_RS24690 membrane-bound lytic murein transglycosylase MltF (Pseudomonas fluorescens SBW25)
MFSPTALRPRCAKWLIATGLFLMLSACVDKPSTLERIKEDGVLRVVTRNSPATYFQDRNG
ETGFEYELVKRFADDLGVKLEIETADNLDDLFGQLGKPNGPVLAAAGLVSSEQRQAQVRF
SHPYLEVTPQIIYRNGQSRPTNAADLVGKKIMVLKGSTHAEQLAALKKQNPAIEYEESDA
VEVVDLLRMVDEGQIDLTLVDSNEVAMNQVYFPNVRVAFDLGNASNQSWAVAAGDDNSLL
NEINSYLDKVEKNGTLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPKYEKHFRAYAKEE
KVDWRLLAAIGYQESLWQPAVTSKTGVRGLMMLTQNTAQAMGVSNRLDPKQSIMGGAKYL
AKIKDELDDSIAEPDRTWFALAAYNVGTGHLEDARTLAKREGLNPNKWLDVKKMLPRLSQ
KQWYSKTRYGYARGGEPVHFVANIRRYYDILTWVTQPQLEGNQVVEGNLHVPGVDKTKPP
EDNPQL