Protein Info for PFLU_RS24650 in Pseudomonas fluorescens SBW25

Annotation: SIS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01380: SIS
  • amino acids 40 to 158 (119 residues), 56.8 bits, E=1e-19
  • amino acids 194 to 278 (85 residues), 47.6 bits, E=7.4e-17

Best Hits

KEGG orthology group: K00820, glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC: 2.6.1.16] (inferred from 100% identity to pfs:PFLU5026)

Predicted SEED Role

"Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6)" in subsystem Chitin and N-acetylglucosamine utilization or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 3.5.99.6)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis I (5/5 steps found)
• N-acetylglucosamine degradation I (2/2 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• N-acetylglucosamine degradation II (2/3 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis II (4/6 steps found)
• chitin biosynthesis (5/9 steps found)
• superpathway of N-acetylneuraminate degradation (14/22 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis III (2/6 steps found)
• superpathway of N-acetylglucosamine, N-acetylmannosamine and N-acetylneuraminate degradation (2/6 steps found)
• chitin derivatives degradation (2/8 steps found)
• chitin degradation I (archaea) (1/7 steps found)
• CMP-legionaminate biosynthesis I (2/10 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (9/24 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Glutamate metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.16

Use Curated BLAST to search for 2.6.1.16 or 3.5.99.6

Sequence Analysis Tools

See C3K1I5 at UniProt or InterPro

Protein Sequence (336 amino acids)

>PFLU_RS24650 SIS domain-containing protein (Pseudomonas fluorescens SBW25)
MLEEALASCDAVAAQLQRLDPLLEEVAGRLRRQPPQVAMTIARGSSDHAASYFAYLAMQH
VGIPVASLPMSVVTLLQAPMKVSGQVAFGFSQSGQSPDLVNSLRLLRKRGALSVSLVNAE
DSPLEAACEFHIPLCAGPEHSVAATKSFIATLSASALLIGHWNQEADLLEACRALPDELR
TAAKQDWTTAIDALRDCQQLMVIGRGAGFAIAQEAALKLKETSAIQAEAFSSAEVRHGPM
ALIGDNYPLLVFAPRGAEQAGLLSLAADMRQRGARVLLAAPDDIAERDLTLSRAEHPSLD
PILAIQSFYVMAAGLAVARGMDPDQPRHLSKVTRTH