Protein Info for PFLU_RS24510 in Pseudomonas fluorescens SBW25

Annotation: virulence factor family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details PF06057: VirJ" amino acids 233 to 418 (186 residues), 253.4 bits, see alignment E=7.7e-80

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU4998)

Predicted SEED Role

"Type IV secretory pathway, VirJ component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K1B1 at UniProt or InterPro

Protein Sequence (428 amino acids)

>PFLU_RS24510 virulence factor family protein (Pseudomonas fluorescens SBW25)
MIRRSWRYVLAFVVLLALILGGGYWYWNRPAPQPTLEQLPQADGSVMTRVTPYGTPKARV
AVAVMADETLTDSQLIALSQGGKAQIVQVILPKDDCKLQEQALQNALGQLKGPATLVSGI
GPGASLAWRWLAAQSDDKANAISVGFAMTQPGCNDPLPKTSAHGNWLVAWNDNPEDDAAS
FVRDTPRATTSISDYDIHYPQVLNNELRKQLVGSDNGGLAIPVVEVPAGQAKDTVTLFLS
GDGGWRDLDRDVAGEMAKIGYPVVGIDTLRYYWQHKSPEQSAKDLTELMQHYRQKWGTKR
FVLTGYSFGADVLPAIYNRLPENEQQRVDAIILLAFARTGSFEIEVEGWLGNAGKEAATG
PEMAKLPPEKVVCIYGAEEVDESGCTDKTAVGEALKLPGGHHFDENYPALAKRLVDIIVK
HQAKDKAE