Protein Info for PFLU_RS24315 in Pseudomonas fluorescens SBW25

Annotation: HAMP domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details transmembrane" amino acids 212 to 232 (21 residues), see Phobius details PF00672: HAMP" amino acids 228 to 279 (52 residues), 38.6 bits, see alignment 1.6e-13 PF00512: HisKA" amino acids 285 to 326 (42 residues), 34.5 bits, see alignment 2.6e-12 PF02518: HATPase_c" amino acids 384 to 486 (103 residues), 74.3 bits, see alignment E=1.6e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU4961)

Predicted SEED Role

"Integral membrane sensor signal transduction histidine kinase (EC 2.7.13.3), glucose catabolism cluster" (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K174 at UniProt or InterPro

Protein Sequence (489 amino acids)

>PFLU_RS24315 HAMP domain-containing protein (Pseudomonas fluorescens SBW25)
MPTEPLTERRRRFPVPRSLLGRMLLLTLLAVLFAQALSSVIWVSQLRATQLEGLVTSARS
LAHSMTASVSYFRSLPVAYRPLVLDQLRSMGGTRFVVTLNDRPLDMAILPQTPRKQAVLE
AVDEVLKQTLGADVHMSVEFVSAEDLRIFNAGLKLDELPRSWAHYALTLEPVNPPVLVTQ
IQLAQGEWLYIASLLPEPYTSLEEQGLPSQQVWFIVLTSGFLLLFIGLLVHWQSRPLKRL
ARAARDMSLGADVEPVAEGGGSEVVEVGRAFNAMRERISRYLTERSQLFSAISHDLRTPI
TRLRLRVELLEDENLQAKFGRDLDELELLVKGALQCVKDTDIHENIEPVDLNHVLDCLVE
PYLAPNGNGRVTQHGRALTTYPGKPLALKRCIGNLIDNALKYGQNAHLHIEDDGAEFILH
VDDEGPGVPEQRLEQVFEPHFRLAGQQQGYGLGLGIARNIAHSHGGEVSLQNLREGGLRV
TLQLPRGLD