Protein Info for PFLU_RS24050 in Pseudomonas fluorescens SBW25

Annotation: tol-pal system protein YbgF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF16331: TolA_bind_tri" amino acids 61 to 114 (54 residues), 36.7 bits, see alignment E=1.2e-12 TIGR02795: tol-pal system protein YbgF" amino acids 158 to 275 (118 residues), 135.5 bits, see alignment E=6.8e-44 PF13525: YfiO" amino acids 159 to 263 (105 residues), 34.1 bits, see alignment E=8.8e-12 PF13432: TPR_16" amino acids 162 to 227 (66 residues), 38.4 bits, see alignment E=5e-13 PF13174: TPR_6" amino acids 163 to 191 (29 residues), 15.4 bits, see alignment (E = 8.2e-06) amino acids 197 to 227 (31 residues), 17.7 bits, see alignment 1.5e-06 amino acids 233 to 264 (32 residues), 20.7 bits, see alignment 1.7e-07

Best Hits

Swiss-Prot: 79% identical to CPOB_PSEPK: Cell division coordinator CpoB (cpoB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU4906)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JYS0 at UniProt or InterPro

Protein Sequence (278 amino acids)

>PFLU_RS24050 tol-pal system protein YbgF (Pseudomonas fluorescens SBW25)
MRTCRRALTVLALSLAPLAVWAAVPVEDSNSGYNNSGSSYPPAGYGTNGAYAGGAATSAP
SAQGELFNQLQRMQDQLAQQQGAIEVLQNQVNQLKQEGLERYQDLDRRIGAGVTPAATPD
NSSAGGAPSAAAGGAAAGAAAASQAPAASSEPGDPAKEKLYYDAAFDLIKAKDFDRASQA
FTAFLRKYPNSQYAGNAQYWLGEVNLAKGDLQGAGQAFAKVSQLYPKHAKVPDSLYKLAD
VERRLGHTDKVKGILQQVVAQYPGTSAAQLAQRDLQRL