Protein Info for PFLU_RS23865 in Pseudomonas fluorescens SBW25

Annotation: pentapeptide repeat-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF00805: Pentapeptide" amino acids 33 to 67 (35 residues), 15.8 bits, see alignment 1.3e-06 amino acids 82 to 120 (39 residues), 34 bits, see alignment 2.6e-12 amino acids 128 to 165 (38 residues), 21.6 bits, see alignment 1.9e-08 amino acids 167 to 204 (38 residues), 32.4 bits, see alignment 7.9e-12 PF13599: Pentapeptide_4" amino acids 43 to 109 (67 residues), 39.7 bits, see alignment E=7.2e-14 amino acids 63 to 135 (73 residues), 43.7 bits, see alignment E=4e-15 amino acids 129 to 203 (75 residues), 37.7 bits, see alignment E=2.9e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU4869)

Predicted SEED Role

"Quinolone resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JZI8 at UniProt or InterPro

Protein Sequence (227 amino acids)

>PFLU_RS23865 pentapeptide repeat-containing protein (Pseudomonas fluorescens SBW25)
MHHTDIDGGTLQRCELEDLIDQHGGPLRLVGVDLSGADLSRMALDHWVFERCILVQTSFL
GSRLEGTQWKSCRAGHAIFEAANLLEAQFHSCDLNNTRWQRSKLSQASFEHCKLTGANFT
HCASLGLSFSETRLNSAFLSGLSFARTVLNNLDFSDSDLSDADFRKAELIDCSLAHARIN
GANFAGADLRGADLSGFRLNDAKLFKGAVISKAQASMLLSELGLSVA