Protein Info for PFLU_RS23025 in Pseudomonas fluorescens SBW25

Annotation: DNA polymerase III subunit delta'

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 309 to 326 (18 residues), see Phobius details PF13177: DNA_pol3_delta2" amino acids 12 to 158 (147 residues), 154.6 bits, see alignment E=2.3e-49 TIGR00678: DNA polymerase III, delta' subunit" amino acids 13 to 200 (188 residues), 206.3 bits, see alignment E=1.6e-65 PF09115: DNApol3-delta_C" amino acids 211 to 322 (112 residues), 26.9 bits, see alignment E=5.7e-10

Best Hits

Swiss-Prot: 73% identical to HOLB_PSEAE: DNA polymerase III subunit delta' (holB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02341, DNA polymerase III subunit delta' [EC: 2.7.7.7] (inferred from 100% identity to pfs:PFLU4699)

Predicted SEED Role

"DNA polymerase III delta prime subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K0M8 at UniProt or InterPro

Protein Sequence (329 amino acids)

>PFLU_RS23025 DNA polymerase III subunit delta' (Pseudomonas fluorescens SBW25)
MAEAYPWQDSLWQQLAGRAQHAHAYLLHGPVGIGKRDLAERLMASLLCQRPVNLEACGEC
KSCLLLKAGSHPDNYVLEPEEADKAIKVDQVRDLVSFVVQTAQMGGRKVVLIEPVEAMNI
NAANALLKSLEEPSGDTVLLLVSHQSSRLLPTIRSRCVQQACPLPSEAMSLEWLGKALPD
CTEDERVELLTLAAGSPLAAVKLQAQGVREQRALVVDGVKKLIKQEMSATQLAETAWKDI
PLLLLFDWFCDWSSLILRYQLTQDENGLGLPDMRKVVQYLAQKSAQDKVLTIQDWILAQR
QKVLGKANLNRVLLLEALLVQWVGLLGRR